PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10003481
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 199aa    MW: 22352.1 Da    PI: 8.2418
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10003481genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.24.4e-232267146
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                 k+ien+  r+vtfskR+ g++KKA ELS LC+a++aviifs++ k+
  Lus10003481 22 KKIENDAHRYVTFSKRKSGLFKKATELSALCGAQIAVIIFSEHHKV 67
                 68****************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.7E-311473IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.4411474IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-251599IPR002100Transcription factor, MADS-box
CDDcd002651.57E-301579No hitNo description
PRINTSPR004049.8E-201636IPR002100Transcription factor, MADS-box
PfamPF003198.0E-232369IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-203651IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-205172IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MAGKKHQQAK KPSKGRQKIE IKKIENDAHR YVTFSKRKSG LFKKATELSA LCGAQIAVII  60
FSEHHKVFSC GRPDVDSLLR QTSPNLALNH NNNNNDHRGN SVNYNDFNGN FGIDNTMMAS  120
SESMQKQEYV KAVETLEEGK RHVTALAALS DSTTREEFWW EGWAVDAMEE KDEVQSYKEA  180
LMELKEKVSA RVGSMQDG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-1515101181Myocyte-specific enhancer factor 2A
3kov_B1e-1515101181Myocyte-specific enhancer factor 2A
3kov_I1e-1515101181Myocyte-specific enhancer factor 2A
3kov_J1e-1515101181Myocyte-specific enhancer factor 2A
3p57_A1e-1515101181Myocyte-specific enhancer factor 2A
3p57_B1e-1515101181Myocyte-specific enhancer factor 2A
3p57_C1e-1515101181Myocyte-specific enhancer factor 2A
3p57_D1e-1515101181Myocyte-specific enhancer factor 2A
3p57_I1e-1515101181Myocyte-specific enhancer factor 2A
3p57_J1e-1515101181Myocyte-specific enhancer factor 2A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-24AGAMOUS-like 62